Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC20 Peptide - N-terminal region

CDC20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C87100, p55CDC, 2310042N09Rik

UniProt

Q9JJ66

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075712.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]
TA500869BM 100 µL

LOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B7]

Sign In for Pricing
View Details
EnzyChrom™ Alanine Transaminase Assay Kit
EALT-100 100 Tests

EnzyChrom™ Alanine Transaminase Assay Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS620272 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
S100A5 (NM_002962) Human Recombinant Protein
TP310891M 100 µg

S100A5 (NM_002962) Human Recombinant Protein

Sign In for Pricing
View Details
HIV TaqMan Probe/Primer and Control Set
TM33710 100 Reactions

HIV TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
Nck (NCK1) Human Gene Knockout Kit (CRISPR)
KN402869 1 Kit

Nck (NCK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details