What is the catalog number for IRF4 Peptide - N-terminal region?

The catalog number for IRF4 Peptide - N-terminal region is orb1997857.

What sizes are available for IRF4 Peptide - N-terminal region?

IRF4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is IRF4 Peptide - N-terminal region in stock?

IRF4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IRF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Spip, IRF-4, LSIRF, AI385587

UniProt

Q64287

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038702.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K3232403 1.0 µg DNA

Bet3l sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing

View Details

WGA81421-01 250 mg

2-[2- (Propan-2-yloxy) phenyl]acetic acid

Sign In for Pricing

View Details

WGA81421-02 2.5 g

2-[2- (Propan-2-yloxy) phenyl]acetic acid

Sign In for Pricing

View Details

NBP3-11601B 0.1 mL

Mouse Monoclonal GnRHR Antibody (A9E4) [Biotin]

Sign In for Pricing

View Details

E47R19210 100 µL

NEU2 Rabbit pAb

Sign In for Pricing

View Details

MBS9311311-01 48 Well

Human Cadherin, Retinal (RCAD) ELISA Kit

Sign In for Pricing

View Details