What is the catalog number for IRF4 Peptide - N-terminal region?

The catalog number for IRF4 Peptide - N-terminal region is orb1997857.

What sizes are available for IRF4 Peptide - N-terminal region?

IRF4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is IRF4 Peptide - N-terminal region in stock?

IRF4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IRF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Spip, IRF-4, LSIRF, AI385587

UniProt

Q64287

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038702.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10R-5791 100 ul

SIL1 antibody

Sign In for Pricing

View Details

E45R24476N 50 ul

[KO Validated] RAB27A Rabbit pAb

Sign In for Pricing

View Details

SI105989A 1 Each

Mouse H1f10 Pre-designed siRNA Set A

Sign In for Pricing

View Details

GTR15317313 1 Vial

Lentiviral human FAM13A shRNA (UAS) - Lentiviral human FAM13A shRNA (UAS) (100)

Sign In for Pricing

View Details

RD266560A-01 60 μL

TBRG4 Polyclonal Antibody

Sign In for Pricing

View Details

RD266560A-02 120 μL

TBRG4 Polyclonal Antibody

Sign In for Pricing

View Details