IRF1 Peptide - middle region
IRF1 Peptide - middle region
Product Specifications
Product Name Alternative
Irf-1, AU020929
UniProt
P15314
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001152868.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx500729 96 Tests
Rat Cholinergic Receptor, Nicotinic, Epsilon (CHRNE) ELISA Kit
Sign In for Pricing
View Details 
RPU60673-01 50 µg
Human Interferon Gamma Receptor 2, Active Protein
Sign In for Pricing
View Details RPU60673-02 100 µg
Human Interferon Gamma Receptor 2, Active Protein
Sign In for Pricing
View Details