IRF1 Peptide - middle region
IRF1 Peptide - middle region
Product Specifications
Product Name Alternative
Irf-1, AU020929
UniProt
P15314
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001152868.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx385382 96 Tests
Human Protein salvador homolog 1 (SAV1) ELISA Kit
Sign In for Pricing
View Details 
28159156 3x 1.0 µg DNA
MBD1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details