Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP13 Peptide - middle region

MMP13 Peptide - middle region

Product Specifications

Product Name Alternative

Clg, Mmp1, MMP-13

UniProt

P33435

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032633.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NABC1 (BCAS1) (C-term) Rabbit Polyclonal Antibody
AP23505PU-N 50 µg

NABC1 (BCAS1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SULt2a4 Mouse Gene Knockout Kit (CRISPR)
KN516969 1 Kit

SULt2a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10G2]
TA806575AM 100 µL

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10G2]

Sign In for Pricing
View Details
3-Phenoxy-1,2-propanediol(>90%)
TRC-P318908-50MG 50 mg

3-Phenoxy-1,2-propanediol(>90%)

Sign In for Pricing
View Details
GLB1L2 (NM_138342) Human Over-expression Lysate
LC403354 20 µg

GLB1L2 (NM_138342) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-(-)-Ibuprofen
TRC-I140005-500MG 500 mg

(R)-(-)-Ibuprofen

Sign In for Pricing
View Details