Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP13 Peptide - middle region

MMP13 Peptide - middle region

Product Specifications

Product Name Alternative

Clg, Mmp1, MMP-13

UniProt

P33435

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032633.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGETMIFKDRFFWRLHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-Chlorofluorene
TRC-C366250-1G 1 g

9-Chlorofluorene

Sign In for Pricing
View Details
2’,3’,5’-Tri-O-benzoyl Xanthine-13C5
TRC-T771512-10MG 10 mg

2’,3’,5’-Tri-O-benzoyl Xanthine-13C5

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS805940 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB506483 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
KAT2A (C-term) Rabbit Polyclonal Antibody
AP52291PU-N 400 µL

KAT2A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TECK (CCL25) (Center) Rabbit Polyclonal Antibody
AP50803PU-N 400 µL

TECK (CCL25) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details