Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UST Peptide - middle region

UST Peptide - middle region

Product Specifications

Product Name Alternative

UA2OST, D930010O20Rik

UniProt

Q8BUB6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_796361.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA01109-25T - Human MPO Primer Pair 3
OOCA01109-25T 25 Tests

OOCA01109-25T - Human MPO Primer Pair 3

Sign In for Pricing
View Details
Integrin beta 3/ITGB3 Rabbit Polyclonal Antibody (PE)
orb2594592 100 µg

Integrin beta 3/ITGB3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CRILE Artery Forceps-Cvd/33*1.7mm/14.5cm#
F21016-14 1 PC

CRILE Artery Forceps-Cvd/33*1.7mm/14.5cm#

Sign In for Pricing
View Details
Phospho-RSK2 (Ser227) Rabbit mAb
MBS8603388-01 0.1 mL

Phospho-RSK2 (Ser227) Rabbit mAb

Sign In for Pricing
View Details
Phospho-RSK2 (Ser227) Rabbit mAb
MBS8603388-02 0.1 mL (AF405L)

Phospho-RSK2 (Ser227) Rabbit mAb

Sign In for Pricing
View Details
Phospho-RSK2 (Ser227) Rabbit mAb
MBS8603388-03 0.1 mL (AF405S)

Phospho-RSK2 (Ser227) Rabbit mAb

Sign In for Pricing
View Details