Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UST Peptide - middle region

UST Peptide - middle region

Product Specifications

Product Name Alternative

UA2OST, D930010O20Rik

UniProt

Q8BUB6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_796361.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complex III Subunit 5   monoclonal antibody
MB11536 50ul

Complex III Subunit 5 monoclonal antibody

Sign In for Pricing
View Details
FSBP Antibody
MBS9232938-01 0.1 mL

FSBP Antibody

Sign In for Pricing
View Details
FSBP Antibody
MBS9232938-02 5x 0.1 mL

FSBP Antibody

Sign In for Pricing
View Details
SSX2 (NM_175698) Human Over-expression Lysate
LC406256 20 µg

SSX2 (NM_175698) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human CCDC14 shRNA (UAS) - Lentiviral human CCDC14 shRNA (UAS, GFP) (25)
GTR15324083 1 Vial

Lentiviral human CCDC14 shRNA (UAS) - Lentiviral human CCDC14 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FAT10 Antibody - C-terminal region
OAAB07562-400UL 400 µL

FAT10 Antibody - C-terminal region

Sign In for Pricing
View Details