Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VILL Peptide - middle region

VILL Peptide - middle region

Product Specifications

Product Name Alternative

Villp

UniProt

Q91YD6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158039.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVLEGQEPLYFWEALGGRAPYPSNKRLPEEVWSIQPRLFECSSHAGCLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL12P41 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV776512 1.0 µg DNA

RPL12P41 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human RTP2 Knockout A549 cell line
GTR15417078 1 Vial

Human RTP2 Knockout A549 cell line

Sign In for Pricing
View Details
JNK-IN-13
BA6468-100 100 mg

JNK-IN-13

Sign In for Pricing
View Details
YT Broth (Powder)
Y2085-01 500 g

YT Broth (Powder)

Sign In for Pricing
View Details
YT Broth (Powder)
Y2085-02 2.5 Kg

YT Broth (Powder)

Sign In for Pricing
View Details
SFPQ Antibody, HRP conjugated
CSB-PA021136LB01HU-01 50 µg

SFPQ Antibody, HRP conjugated

Sign In for Pricing
View Details