Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VILL Peptide - middle region

VILL Peptide - middle region

Product Specifications

Product Name Alternative

Villp

UniProt

Q91YD6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158039.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVLEGQEPLYFWEALGGRAPYPSNKRLPEEVWSIQPRLFECSSHAGCLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
27717151 3x 1.0 µg DNA

LRRN1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
BAG5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
12985064 1.0 µg DNA

BAG5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OR5G1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV737761 1.0 µg DNA

OR5G1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
MAS1L shRNA Plasmid (h)
sc-95358-SH 20 µg

MAS1L shRNA Plasmid (h)

Sign In for Pricing
View Details
Human UBL7 Pre-designed siRNA Set A
SI017744A 1 Each

Human UBL7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
5-Lipoxygenase (5-LO) Monoclonal Antibody
CAU33592-01 100 µL

5-Lipoxygenase (5-LO) Monoclonal Antibody

Sign In for Pricing
View Details