Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL1 Peptide - C-terminal region

ISL1 Peptide - C-terminal region

Product Specifications

UniProt

P61372

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067434.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM5 Conjugated Antibody
MBS9443249-01 0.1 mL (Biotin)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details
CEACAM5 Conjugated Antibody
MBS9443249-02 0.1 mL (AF350)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details
CEACAM5 Conjugated Antibody
MBS9443249-03 0.1 mL (AF405)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details
CEACAM5 Conjugated Antibody
MBS9443249-04 0.1 mL (AF488)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details
CEACAM5 Conjugated Antibody
MBS9443249-05 0.1 mL (AF555)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details
CEACAM5 Conjugated Antibody
MBS9443249-06 0.1 mL (AF594)

CEACAM5 Conjugated Antibody

Sign In for Pricing
View Details