Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL1 Peptide - C-terminal region

ISL1 Peptide - C-terminal region

Product Specifications

UniProt

P61372

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067434.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W
EIA05837r 1 Kit

W

Sign In for Pricing
View Details
IER5 Protein Vector (Human) (pPM-C-His)
PV085368 500 ng

IER5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MSBP3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1347904 1.0 µg DNA

MSBP3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC25A6 Over-expression Lysate Product
GWB-2D18CA 0.1 mg

SLC25A6 Over-expression Lysate Product

Sign In for Pricing
View Details
HMGA1L6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0969505 3x 1.0 µg

HMGA1L6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Graduated cylinder, 100mL
601573-1 1 Each

Graduated cylinder, 100mL

Sign In for Pricing
View Details