Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCN Peptide - middle region

DCN Peptide - middle region

Product Specifications

Product Name Alternative

DC, PG40, PGII, PGS2, DSPG2, SLRR1B

UniProt

P28654

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177380.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt1a1 3'UTR Luciferase Stable Cell Line
TU121546 1.0 mL

Ugt1a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal MyoD Antibody [Alexa Fluor 405]
NBP1-54153AF405 0.1 mL

Rabbit Polyclonal MyoD Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
CTSA Protein Vector (Human) (pPB-N-His)
PV011118 500 ng

CTSA Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GLT (LGALS1, Galectin-1, 14kD laminin-binding protein, 14kD lectin, Beta-galactoside-binding lectin L-14-I, Galaptin, HBL, HPL, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, Putative MAPK-activating protein PM12, S-Lac lectin 1) (MaxLight 490) discontinued
036097-ML490 100 µL

GLT (LGALS1, Galectin-1, 14kD laminin-binding protein, 14kD lectin, Beta-galactoside-binding lectin L-14-I, Galaptin, HBL, HPL, Lactose-binding lectin 1, Lectin galactoside-binding soluble 1, Putative MAPK-activating protein PM12, S-Lac lectin 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
OPN1LW Protein Vector (Human) (pPB-N-His)
PV105727 500 ng

OPN1LW Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
KIAA1958 CRISPRa sgRNA lentivector (set of three targets)(Human)
25646121 3x 1.0µg DNA

KIAA1958 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details