Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY1 Peptide - middle region

CRY1 Peptide - middle region

Product Specifications

Product Name Alternative

Phll1, AU020726, AU021000

UniProt

P97784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031797.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fuz activation kit by CRISPRa
GA208470 1 Kit

Mouse Fuz activation kit by CRISPRa

Sign In for Pricing
View Details
Ubiquinol-Cytochrome C Reductase Core Protein I Recombinant Rabbit monoclonal Antibody
HA750699 100 µL

Ubiquinol-Cytochrome C Reductase Core Protein I Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NDUFV1 (NM_007103) Human Recombinant Protein
TP304954 20 µg

NDUFV1 (NM_007103) Human Recombinant Protein

Sign In for Pricing
View Details
CBLL2 Antibody
KC-1952-01 50 μL

CBLL2 Antibody

Sign In for Pricing
View Details
CBLL2 Antibody
KC-1952-02 100 µL

CBLL2 Antibody

Sign In for Pricing
View Details
CBLL2 Antibody
KC-1952-03 1 mL

CBLL2 Antibody

Sign In for Pricing
View Details