Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY1 Peptide - middle region

CRY1 Peptide - middle region

Product Specifications

Product Name Alternative

Phll1, AU020726, AU021000

UniProt

P97784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031797.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4galt6 (NM_019737) Mouse Over-expression Lysate
LC705973 20 µg

B4galt6 (NM_019737) Mouse Over-expression Lysate

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein Mouse Monoclonal Antibody [A4G9] - BSA and Azide free (Detector)
HA600005 100 µg

SARS-CoV-2 Nucleocapsid protein Mouse Monoclonal Antibody [A4G9] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Saccharin
TRC-S080800-50G 50 g

Saccharin

Sign In for Pricing
View Details
ZC3H12C (NM_033390) Human Recombinant Protein
TP323705 20 µg

ZC3H12C (NM_033390) Human Recombinant Protein

Sign In for Pricing
View Details
rac N’-Nitrosonornicotine 5’-Acetate (Mixture of Diastereomers)
TRC-N534995-5MG 5 mg

rac N’-Nitrosonornicotine 5’-Acetate (Mixture of Diastereomers)

Sign In for Pricing
View Details
AMPD3 (NM_000480) Human Over-expression Lysate
LC424690 20 µg

AMPD3 (NM_000480) Human Over-expression Lysate

Sign In for Pricing
View Details