Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIA Peptide - C-terminal region

PPIA Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cphn, CypA, CyP-18, 2700098C05

UniProt

P17742

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032933.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP20 (NM_006676) Human Over-expression Lysate
LY402002 100 µg

USP20 (NM_006676) Human Over-expression Lysate

Sign In for Pricing
View Details
SH2D7 (NM_001101404) Human Over-expression Lysate
LY426158 100 µg

SH2D7 (NM_001101404) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta-Cyanobenzenepropanoic Acid Ethyl Ester
TRC-C962355-250MG 250 mg

Beta-Cyanobenzenepropanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Med21 (NM_025315) Mouse Tagged ORF Clone
MG200953 10 µg

Med21 (NM_025315) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NAT1 (NM_000662) Human Over-expression Lysate
LC424588 20 µg

NAT1 (NM_000662) Human Over-expression Lysate

Sign In for Pricing
View Details
Pyridoxine Dimer (80%)
TRC-P991225-50MG 50 mg

Pyridoxine Dimer (80%)

Sign In for Pricing
View Details