Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIA Peptide - C-terminal region

PPIA Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cphn, CypA, CyP-18, 2700098C05

UniProt

P17742

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032933.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PPA1 Antibody
RC-4720-01 50 μL

Recombinant PPA1 Antibody

Sign In for Pricing
View Details
Recombinant PPA1 Antibody
RC-4720-02 100 µL

Recombinant PPA1 Antibody

Sign In for Pricing
View Details
Recombinant PPA1 Antibody
RC-4720-03 1 mL

Recombinant PPA1 Antibody

Sign In for Pricing
View Details
Human IFITM5 activation kit by CRISPRa
GA117904 1 Kit

Human IFITM5 activation kit by CRISPRa

Sign In for Pricing
View Details
C2CD4A (NM_207322) Human Over-expression Lysate
LC404099 20 µg

C2CD4A (NM_207322) Human Over-expression Lysate

Sign In for Pricing
View Details
Z-VAL-MET-OH
TRC-V991690-1G 1 g

Z-VAL-MET-OH

Sign In for Pricing
View Details