Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORA Peptide - middle region

RORA Peptide - middle region

Product Specifications

Product Name Alternative

Sg, ROR1, ROR2, ROR3, Nr1f1, nmf267, tmgc26, staggerer, 9530021D13Rik

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001276845.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1D (C1D Nuclear Receptor Corepressor, LRP1, hC1D, SUNCOR, SUN-CoR) (APC)
MBS6445338-01 0.1 mL

C1D (C1D Nuclear Receptor Corepressor, LRP1, hC1D, SUNCOR, SUN-CoR) (APC)

Sign In for Pricing
View Details
C1D (C1D Nuclear Receptor Corepressor, LRP1, hC1D, SUNCOR, SUN-CoR) (APC)
MBS6445338-02 5x 0.1 mL

C1D (C1D Nuclear Receptor Corepressor, LRP1, hC1D, SUNCOR, SUN-CoR) (APC)

Sign In for Pricing
View Details
BLZF1 Peptide - N-terminal region
orb2020112 100 µg

BLZF1 Peptide - N-terminal region

Sign In for Pricing
View Details
Flamma® 675NA NHS ester
PNS1515_1 mg 1 mg

Flamma® 675NA NHS ester

Sign In for Pricing
View Details
BTF3 Human Over-expression Lysate
orb1343380 100 µg

BTF3 Human Over-expression Lysate

Sign In for Pricing
View Details
Naphthalene, 2- (3-chlorophenyl) -
JH915939 1 Each

Naphthalene, 2- (3-chlorophenyl) -

Sign In for Pricing
View Details