Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RORA Peptide - middle region

RORA Peptide - middle region

Product Specifications

Product Name Alternative

Sg, ROR1, ROR2, ROR3, Nr1f1, nmf267, tmgc26, staggerer, 9530021D13Rik

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001276845.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMSB4XP7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV787108 1.0 µg DNA

TMSB4XP7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Bub3 Antibody
orb74840 100 µL

Bub3 Antibody

Sign In for Pricing
View Details
Anti-Catalase Rabbit Monoclonal Antibody
MA1639-.05 50 µL

Anti-Catalase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human BTN3A3 Protein (Fc tag)
MBS2545314-01 0.1 mg

Recombinant Human BTN3A3 Protein (Fc tag)

Sign In for Pricing
View Details
Recombinant Human BTN3A3 Protein (Fc tag)
MBS2545314-02 5x 0.1 mg

Recombinant Human BTN3A3 Protein (Fc tag)

Sign In for Pricing
View Details
CHRNG Protein Vector (Mouse) (pPM-C-HA)
PV165476 500 ng

CHRNG Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details