Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Peptide - C-terminal region

TCF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Tcf1, TCF-1, AI465550

UniProt

Q00417

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300910.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS806160 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
NCF2 (NM_000433) Human Over-expression Lysate
LC400154 20 µg

NCF2 (NM_000433) Human Over-expression Lysate

Sign In for Pricing
View Details
Bromodichloroacetic Acid
TRC-B590900-50MG 50 mg

Bromodichloroacetic Acid

Sign In for Pricing
View Details
Boscalid
TRC-B675850-1G 1 g

Boscalid

Sign In for Pricing
View Details
CDR1 Human Gene Knockout Kit (CRISPR)
KN417579 1 Kit

CDR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SYNPR (NM_144642) Human Recombinant Protein
TP305424 20 µg

SYNPR (NM_144642) Human Recombinant Protein

Sign In for Pricing
View Details