Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Peptide - C-terminal region

TCF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Tcf1, TCF-1, AI465550

UniProt

Q00417

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300910.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-4-chloro-3-indolyl caprylate
TRC-B871023-500MG 500 mg

5-Bromo-4-chloro-3-indolyl caprylate

Sign In for Pricing
View Details
NuMA (NUMA1) Human Knockdown Lysate
LY300382 100 µg

NuMA (NUMA1) Human Knockdown Lysate

Sign In for Pricing
View Details
LOXL2 Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF807441 100 µg

LOXL2 Mouse Monoclonal Antibody [Clone ID: OTI2A7]

Sign In for Pricing
View Details
POU4F3 Mouse Monoclonal Antibody [Clone ID: OTI3A12]
CF808731 100 µg

POU4F3 Mouse Monoclonal Antibody [Clone ID: OTI3A12]

Sign In for Pricing
View Details
AM 404
TRC-A575810-250MG 250 mg

AM 404

Sign In for Pricing
View Details
Slc2a5 Mouse Gene Knockout Kit (CRISPR)
KN516032 1 Kit

Slc2a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details