Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Peptide - middle region

WWOX Peptide - middle region

Product Specifications

Product Name Alternative

WOX1, 5330426P09Rik, 9030416C10Rik

UniProt

Q91WL8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_062519.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEMO1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
28351124 3x 1.0µg DNA

MEMO1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TmLHE (NM_001184797) Human Tagged ORF Clone
RG229965 10 µg

TmLHE (NM_001184797) Human Tagged ORF Clone

Sign In for Pricing
View Details
DPAS Stain Kit
RRSK150-100 100 Tests

DPAS Stain Kit

Sign In for Pricing
View Details
Anti-Hu CD261 APC
1A-403-C100 0.1 mg

Anti-Hu CD261 APC

Sign In for Pricing
View Details
2-Bromo-4-chloro-5-fluorophenol
PC57127-01 250 mg

2-Bromo-4-chloro-5-fluorophenol

Sign In for Pricing
View Details
2-Bromo-4-chloro-5-fluorophenol
PC57127-02 1 g

2-Bromo-4-chloro-5-fluorophenol

Sign In for Pricing
View Details