WWOX Peptide - middle region
WWOX Peptide - middle region
Product Specifications
Product Name Alternative
WOX1, 5330426P09Rik, 9030416C10Rik
UniProt
Q91WL8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_062519.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1362463-01 0.02 mg (E-Coli)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1362463-02 0.1 mg (E-Coli)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1362463-03 0.02 mg (Yeast)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1362463-04 0.1 mg (Yeast)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1362463-05 0.02 mg (Baculovirus)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details MBS1362463-06 1 mg (E-Coli)
Recombinant Macaca fascicularis Growth/differentiation factor 8 (MSTN)
Sign In for Pricing
View Details