Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA Peptide - N-terminal region

SLA Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLA1, SLAP

UniProt

Q13239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001039021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBA6 activation kit by CRISPRa
GA110631 1 Kit

Human UBA6 activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp407 Mouse Gene Knockout Kit (CRISPR)
KN519823 1 Kit

Zfp407 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
Human SPOCD1 activation kit by CRISPRa
GA114066 1 Kit

Human SPOCD1 activation kit by CRISPRa

Sign In for Pricing
View Details