Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA Peptide - N-terminal region

SLA Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLA1, SLAP

UniProt

Q13239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001039021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR9243
TRC-S684475-5MG 5 mg

SR9243

Sign In for Pricing
View Details
NAT1 Human Gene Knockout Kit (CRISPR)
KN221042BN 1 Kit

NAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF405S conjugate, 0.1mg/mL
BNC042085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCN2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]
TA806802AM 100 µL

CCN2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL
BNC471784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIC5 (TGFB1I1) (NM_015927) Human Over-expression Lysate
LC402475 20 µg

HIC5 (TGFB1I1) (NM_015927) Human Over-expression Lysate

Sign In for Pricing
View Details