What is the catalog number for PBX1 Peptide - middle region?

The catalog number for PBX1 Peptide - middle region is orb1997838.

What sizes are available for PBX1 Peptide - middle region?

PBX1 Peptide - middle region is available in the following size(s): 100 µg.

Is PBX1 Peptide - middle region in stock?

PBX1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PBX1 Peptide - middle region

Product Specifications

UniProt

P40424

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191892.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV084617 500 ng

HRG Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details

46734111 3x 1.0 µg

TINAGL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

A2987-1mg 1 mg

Ongericimab (Anti-PCSK9)

Sign In for Pricing

View Details

orb928991 100 µL

C8orf42 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing

View Details

40304091 4x 500 ng

RNF26-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing

View Details

GTR15209542 1 Vial

Lentiviral mouse Fnbp1l shRNA (UAS) - Lentiviral mouse Fnbp1l shRNA (UAS, GFP) plasmid

Sign In for Pricing

View Details