Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBX1 Peptide - middle region

PBX1 Peptide - middle region

Product Specifications

UniProt

P40424

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191892.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHD2 shRNA (UAS) - Lentiviral human CHD2 shRNA (UAS, RFP) (25)
GTR15108251 1 Vial

Lentiviral human CHD2 shRNA (UAS) - Lentiviral human CHD2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Aoc3 (NM_009675) Mouse Tagged ORF Clone
MR209593 10 µg

Aoc3 (NM_009675) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SHIP-1 (D-11) : m-IgG1 BP-HRP Bundle
sc-542495 1 Kit

SHIP-1 (D-11) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
FPR1 antagonist 3
T207590-01 10 mg

FPR1 antagonist 3

Sign In for Pricing
View Details
FPR1 antagonist 3
T207590-02 50 mg

FPR1 antagonist 3

Sign In for Pricing
View Details
RCC2 CRISPR Activation Plasmid (m)
sc-430875-ACT 20 µg

RCC2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details