Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPP Peptide - N-terminal region

LPP Peptide - N-terminal region

Product Specifications

Product Name Alternative

C79715, AA959454, AU024130, D630048H16, 9430020K16Rik, B130055L10Rik

UniProt

Q8BFW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139424.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGNPSISVSTQQPPKKYAPVVAPKPKYNPYKQPGGEGDLLPPPPPPLEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF568 conjugate, 0.1mg/mL
BNC682173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8D9]
TA500783AM 100 µL

AKT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8D9]

Sign In for Pricing
View Details
SequaGel MD SSCP Kit (Haz Fee)
EC-846 1 Kit

SequaGel MD SSCP Kit (Haz Fee)

Sign In for Pricing
View Details
1-(4-Formylphenyl)-4-piperidinecarboxylic Acid
TRC-B594025-50MG 50 mg

1-(4-Formylphenyl)-4-piperidinecarboxylic Acid

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), Biotin conjugate, 0.1mg/mL
BNCB2424-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2424), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGAM4 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF810791 100 µg

PGAM4 Mouse Monoclonal Antibody [Clone ID: OTI1A1]

Sign In for Pricing
View Details