Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPP Peptide - N-terminal region

LPP Peptide - N-terminal region

Product Specifications

Product Name Alternative

C79715, AA959454, AU024130, D630048H16, 9430020K16Rik, B130055L10Rik

UniProt

Q8BFW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139424.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGNPSISVSTQQPPKKYAPVVAPKPKYNPYKQPGGEGDLLPPPPPPLEDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin alpha 4 (LAMA4) (NM_001105206) Human Over-expression Lysate
LY426227 100 µg

Laminin alpha 4 (LAMA4) (NM_001105206) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF488A conjugate, 0.1mg/mL
BNC882222-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Galectin-14/LGALS14 Protein (His Tag)
PKSH032472-01 10 µg

Recombinant Human Galectin-14/LGALS14 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Galectin-14/LGALS14 Protein (His Tag)
PKSH032472-02 50 µg

Recombinant Human Galectin-14/LGALS14 Protein (His Tag)

Sign In for Pricing
View Details
ANKRD16 (NM_001009941) Human Recombinant Protein
TP315131 20 µg

ANKRD16 (NM_001009941) Human Recombinant Protein

Sign In for Pricing
View Details
Human ZNF101 activation kit by CRISPRa
GA114321 1 Kit

Human ZNF101 activation kit by CRISPRa

Sign In for Pricing
View Details