Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A1 Peptide - middle region

UGT1A1 Peptide - middle region

Product Specifications

Product Name Alternative

Gnt1, UgtBr1, UGT1A01, Udpgt-1a, UDPGT 1-1

UniProt

Q63886

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_964007.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trfp (MED20) (NM_004275) Human Over-expression Lysate
LC401368 20 µg

trfp (MED20) (NM_004275) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin V-APC/Cyanine7 Reagent
E-CK-A129-01 50 Tests

Annexin V-APC/Cyanine7 Reagent

Sign In for Pricing
View Details
Annexin V-APC/Cyanine7 Reagent
E-CK-A129-02 200 Tests

Annexin V-APC/Cyanine7 Reagent

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF405S conjugate, 0.1mg/mL
BNC042312-100 1x 100 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), CF647 conjugate, 0.1mg/mL
BNC473230-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Octylphosphonic Acid (NOPA)
TRC-O293890-25G 25 g

Octylphosphonic Acid (NOPA)

Sign In for Pricing
View Details