Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A1 Peptide - middle region

UGT1A1 Peptide - middle region

Product Specifications

Product Name Alternative

Gnt1, UgtBr1, UGT1A01, Udpgt-1a, UDPGT 1-1

UniProt

Q63886

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_964007.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrobenzeneazomalononitrile
TRC-N493275-2G 2 g

4-Nitrobenzeneazomalononitrile

Sign In for Pricing
View Details
Mouse IgM (µ chain specific), AlpSdAbs® VHH
HA710148 100 µg

Mouse IgM (µ chain specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
Tiazofurin
TRC-T437200-50MG 50 mg

Tiazofurin

Sign In for Pricing
View Details
Recombinant Human APN Protein (His Tag)
PKSR030495-01 10 µg

Recombinant Human APN Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human APN Protein (His Tag)
PKSR030495-02 50 µg

Recombinant Human APN Protein (His Tag)

Sign In for Pricing
View Details
TCF4/12 Antibody
8C19176-AAT 50 µg

TCF4/12 Antibody

Sign In for Pricing
View Details