Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNC Peptide - middle region

SYNC Peptide - middle region

Product Specifications

Product Name Alternative

SNIP4, 1110057H03Rik

UniProt

Q9EPM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075974.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLQLQNRNLEDQITLVRQKRDEEVQQYREQLEEMEERQRQLRSGVQVQQQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Droplet Generation Device (80-100 μm)
ATR MCN-G35 1 Piece

Droplet Generation Device (80-100 μm)

Sign In for Pricing
View Details
Smad3 Polyclonal Antibody, Biotin Conjugated
bs-23580R-Biotin 100 µL

Smad3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human FMOD Protein Lysate
MBS8411851-01 0.02 mg

Human FMOD Protein Lysate

Sign In for Pricing
View Details
Human FMOD Protein Lysate
MBS8411851-02 5x 0.02 mg

Human FMOD Protein Lysate

Sign In for Pricing
View Details
Human Cadherin-11 (CDH11) ELISA Kit
RK01080 96 Tests

Human Cadherin-11 (CDH11) ELISA Kit

Sign In for Pricing
View Details
PRPS1L1 Recombinant Protein (Human)
RP085062 100 µg

PRPS1L1 Recombinant Protein (Human)

Sign In for Pricing
View Details