Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNC Peptide - middle region

SYNC Peptide - middle region

Product Specifications

Product Name Alternative

SNIP4, 1110057H03Rik

UniProt

Q9EPM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075974.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLQLQNRNLEDQITLVRQKRDEEVQQYREQLEEMEERQRQLRSGVQVQQQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) (MaxLight 490)
131536-ML490 100 µL

PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) (MaxLight 490)

Sign In for Pricing
View Details
Histone cluster 1 H4D CRISPR/Cas9 KO Plasmid (h)
sc-411161 20 µg

Histone cluster 1 H4D CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
LPPR5 Antibody
abx007258-01 50 µL

LPPR5 Antibody

Sign In for Pricing
View Details
LPPR5 Antibody
abx007258-02 100 µL

LPPR5 Antibody

Sign In for Pricing
View Details
LPPR5 Antibody
abx007258-03 200 µL

LPPR5 Antibody

Sign In for Pricing
View Details
Cst6 Rabbit Polyclonal Antibody (Biotin)
orb2107618 100 µL

Cst6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details