Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY2 Peptide - middle region

CRY2 Peptide - middle region

Product Specifications

Product Name Alternative

AV006279, D130054K12Rik

UniProt

Q9R194

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034093.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY5 siRNA (Human)
orb1868185-01 15 nmol

ADCY5 siRNA (Human)

Sign In for Pricing
View Details
ADCY5 siRNA (Human)
orb1868185-02 30 nmol

ADCY5 siRNA (Human)

Sign In for Pricing
View Details
Matrix Metalloproteinase 10 (MMP-10) Mouse ELISA Kit
E8699 96 Tests

Matrix Metalloproteinase 10 (MMP-10) Mouse ELISA Kit

Sign In for Pricing
View Details
ZFP91 Antibody
56-710 400 µL

ZFP91 Antibody

Sign In for Pricing
View Details
PPGB (20k, Cleaved-Met327) rabbit pAb
MBS8597388-01 0.1 mL

PPGB (20k, Cleaved-Met327) rabbit pAb

Sign In for Pricing
View Details
PPGB (20k, Cleaved-Met327) rabbit pAb
MBS8597388-02 0.1 mL (AF405L)

PPGB (20k, Cleaved-Met327) rabbit pAb

Sign In for Pricing
View Details