Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY2 Peptide - middle region

CRY2 Peptide - middle region

Product Specifications

Product Name Alternative

AV006279, D130054K12Rik

UniProt

Q9R194

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034093.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Interleukin 13 (IL13)
TRV-0014158-01 10 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0014158-02 50 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0014158-03 100 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0014158-04 200 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0014158-05 500 µg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details
Recombinant Interleukin 13 (IL13)
TRV-0014158-06 1 mg

Recombinant Interleukin 13 (IL13)

Sign In for Pricing
View Details