Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN2 Peptide - middle region

MFN2 Peptide - middle region

Product Specifications

Product Name Alternative

Fzo, D630023P19Rik

UniProt

Q80U63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Liver
CP520428 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
ARL6IP4 Human qPCR Primer Pair (NM_018694)
HP231076 200 Reactions

ARL6IP4 Human qPCR Primer Pair (NM_018694)

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), 0.2mg/mL
BNUB2329-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), 0.2mg/mL

Sign In for Pricing
View Details
2,6-Diphenylphenol
TRC-D492230-250MG 250 mg

2,6-Diphenylphenol

Sign In for Pricing
View Details
PSMD11 Human Gene Knockout Kit (CRISPR)
KN401201 1 Kit

PSMD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C20orf96 activation kit by CRISPRa
GA115383 1 Kit

Human C20orf96 activation kit by CRISPRa

Sign In for Pricing
View Details