What is the catalog number for PON1 Peptide - middle region?

The catalog number for PON1 Peptide - middle region is orb1997824.

What sizes are available for PON1 Peptide - middle region?

PON1 Peptide - middle region is available in the following size(s): 100 µg.

Is PON1 Peptide - middle region in stock?

PON1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PON1 Peptide - middle region

Product Specifications

Product Name Alternative

Pon

UniProt

P52430

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLAHKIHVYEKHANWTLTPLKVLNFDTLVDNISVDPVTGDLWVGCHPNGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

46002094 4x 500 ng

Syt17-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing

View Details

TL303799 1 Kit

KCNT2 Human shRNA Plasmid Kit (Locus ID 343450)

Sign In for Pricing

View Details

40888101 1 µg

RPL17P25 AAV Vector (Human) (CMV)

Sign In for Pricing

View Details

MBS7177956 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) UVRC Polyclonal Antibody

Sign In for Pricing

View Details

OR93483-01 100 mg

1- (1,2,3,4-Tetrahydroisoquinolin-7-yl) ethan-1-one hydrochloride

Sign In for Pricing

View Details

OR93483-02 250 mg

1- (1,2,3,4-Tetrahydroisoquinolin-7-yl) ethan-1-one hydrochloride

Sign In for Pricing

View Details