Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PON1 Peptide - middle region

PON1 Peptide - middle region

Product Specifications

Product Name Alternative

Pon

UniProt

P52430

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLAHKIHVYEKHANWTLTPLKVLNFDTLVDNISVDPVTGDLWVGCHPNGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium Transporter Rh type C (RHCG) Porcine ELISA Kit
B4477 96 Tests

Ammonium Transporter Rh type C (RHCG) Porcine ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Transcriptional enhancer factor TEF-1 (C-His)
BP2641-500ug 500 µg

Recombinant Human Transcriptional enhancer factor TEF-1 (C-His)

Sign In for Pricing
View Details
CCDC116 Antibody - C-terminal region
MBS3211114-01 0.1 mL

CCDC116 Antibody - C-terminal region

Sign In for Pricing
View Details
CCDC116 Antibody - C-terminal region
MBS3211114-02 5x 0.1 mL

CCDC116 Antibody - C-terminal region

Sign In for Pricing
View Details
TRIP12 polyclonal antibody
BS71385-01 50 µL

TRIP12 polyclonal antibody

Sign In for Pricing
View Details
TRIP12 polyclonal antibody
BS71385-02 100 µL

TRIP12 polyclonal antibody

Sign In for Pricing
View Details