Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSR Peptide - middle region

GSR Peptide - middle region

Product Specifications

Product Name Alternative

Gr1, Gr-1, AI325518, D8Ertd238e

UniProt

P47791

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034474.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCN2 (C-term) Rabbit Polyclonal Antibody
AP14569PU-N 400 µL

CCN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nano Spectrophotometer BSNA-401
BSNA-401 Each

Nano Spectrophotometer BSNA-401

Sign In for Pricing
View Details
ROR2 (ROR2/1911), CF647 conjugate, 0.1mg/mL
BNC471911-100 1x 100 µL

ROR2 (ROR2/1911), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine-15N
TRC-A280410-5MG 5 mg

Adenosine-15N

Sign In for Pricing
View Details
Mouse Epx activation kit by CRISPRa
GA201278 1 Kit

Mouse Epx activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS501589 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details