Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSR Peptide - middle region

GSR Peptide - middle region

Product Specifications

Product Name Alternative

Gr1, Gr-1, AI325518, D8Ertd238e

UniProt

P47791

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034474.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptprc Mouse Monoclonal Antibody [Clone ID: OX-30]
CL111PX 500 µg

Ptprc Mouse Monoclonal Antibody [Clone ID: OX-30]

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL
BNC401926-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), 1mg/mL
BNUM0296-50 1x 50 µL

Blood Group Antigen B (CD173) (HEB-20), 1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL
BNC470597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Over-expression Lysate
LC421268 20 µg

alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GABRP activation kit by CRISPRa
GA101711 1 Kit

Human GABRP activation kit by CRISPRa

Sign In for Pricing
View Details