Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP7 Peptide - middle region

FABP7 Peptide - middle region

Product Specifications

Product Name Alternative

MRG, Blbp, BFABP, B-FABP

UniProt

P51880

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067247.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF594 conjugate, 0.1mg/mL
BNC941692-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Casp7 Mouse Gene Knockout Kit (CRISPR)
KN502569 1 Kit

Casp7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL2 activation kit by CRISPRa
GA102376 1 Kit

Human IL2 activation kit by CRISPRa

Sign In for Pricing
View Details
ADAM17 Recombinant Rabbit monoclonal Antibody
HA750370 100 µL

ADAM17 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TCP1 delta Rabbit Polyclonal Antibody
HA500308 100 µL

TCP1 delta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ROX Reference Dye *50X fluorescence reference solution for PCR reactions*
400-AAT 5 mL

ROX Reference Dye *50X fluorescence reference solution for PCR reactions*

Sign In for Pricing
View Details