Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Peptide - C-terminal region

CTNNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTNNB, MRD19, armadillo

UniProt

P35222

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001091679.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRG1 (NM_052972) Human Over-expression Lysate
LY403277 100 µg

LRG1 (NM_052972) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF2AK1 Human Gene Knockout Kit (CRISPR)
KN200065BN 1 Kit

EIF2AK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human CD193 Antibody[5E8]
E-AB-F1303A-01 25 µg

Purified Anti-Human CD193 Antibody[5E8]

Sign In for Pricing
View Details
Purified Anti-Human CD193 Antibody[5E8]
E-AB-F1303A-02 100 µg

Purified Anti-Human CD193 Antibody[5E8]

Sign In for Pricing
View Details
SERPING1 Rabbit Polyclonal Antibody
TA381393 100 µL

SERPING1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glass Free (Haz. Fee)
EC-621 450 mL

Glass Free (Haz. Fee)

Sign In for Pricing
View Details