Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Peptide - C-terminal region

CTNNB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTNNB, MRD19, armadillo

UniProt

P35222

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001091679.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox7a2l Mouse Gene Knockout Kit (CRISPR)
KN503731 1 Kit

Cox7a2l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Air Jacketed Incubator BIAJ-105
BIAJ-105 1 Unit

Air Jacketed Incubator BIAJ-105

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Recombinant Protein
TP310897L 1 mg

Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081UE-01 25 µg

APC Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
APC Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081UE-02 100 µg

APC Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
UFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G6]
TA804317BM 100 µL

UFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G6]

Sign In for Pricing
View Details