Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - N-terminal region

BECN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATG6, VPS30, beclin1

UniProt

Q14457

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TALLA-1/TSPAN7 Protein (His Tag)
PKSM040452 100 µg

Recombinant Mouse TALLA-1/TSPAN7 Protein (His Tag)

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF405S conjugate, 0.1mg/mL
BNC041852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UT3-01 25 µg

Elab Fluor® Violet 540 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UT3-02 100 µg

Elab Fluor® Violet 540 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
L-Hercynine-d3
TRC-H288902-2.5MG 2.5 mg

L-Hercynine-d3

Sign In for Pricing
View Details
APOM Human
OM296944-01 10 µg

APOM Human

Sign In for Pricing
View Details