Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - N-terminal region

BECN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATG6, VPS30, beclin1

UniProt

Q14457

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB1 Recombinant Rabbit monoclonal Antibody
HA751624 100 µL

MOB1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ACSM5 (NM_017888) Human Recombinant Protein
TP309798L 1 mg

ACSM5 (NM_017888) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711912 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Bis(3-Aminophenyl) Sulfone
TRC-B405520-50G 50 g

Bis(3-Aminophenyl) Sulfone

Sign In for Pricing
View Details
Tmem235 Mouse Gene Knockout Kit (CRISPR)
KN517821 1 Kit

Tmem235 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Amino-1-hexanol
TRC-A610005-25G 25 g

6-Amino-1-hexanol

Sign In for Pricing
View Details