MOS Peptide - middle region
MOS Peptide - middle region
Product Specifications
UniProt
P00539
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IARLHHDNIVRVVAASTRTPEGSNSLGTIIMEFGGNVTLHQVIYGATRSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS628145-01 0.1 mg
MTHFR (Methylenetetrahydrofolate Reductase (NAD (P) H) )
Sign In for Pricing
View Details MBS628145-02 5x 0.1 mg
MTHFR (Methylenetetrahydrofolate Reductase (NAD (P) H) )
Sign In for Pricing
View Details 
CB233-C8-P 3 µm
Caprisil C8-P HPLC Column, 3 µm, 100 Å, CB533-C8-P x 100 mm
Sign In for Pricing
View Details 
FD103770 50 mg
(6alpha,11beta,16alpha,17alpha) -6,9-Difluoro-11-hydroxy-16,17-[ (1-methylethylidene) bis (oxy) ]-3-oxoandrosta-1,4-diene-17-carboxylic A cid
Sign In for Pricing
View Details