What is the catalog number for MOS Peptide - middle region?

The catalog number for MOS Peptide - middle region is orb1997811.

What sizes are available for MOS Peptide - middle region?

MOS Peptide - middle region is available in the following size(s): 100 µg.

Is MOS Peptide - middle region in stock?

MOS Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MOS Peptide - middle region

Product Specifications

UniProt

P00539

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IARLHHDNIVRVVAASTRTPEGSNSLGTIIMEFGGNVTLHQVIYGATRSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS579419 Inquire

ML264

Sign In for Pricing

View Details

NBP2-98044AF594 0.1 mL

Rabbit Polyclonal KLHL34 Antibody [Alexa Fluor 594]

Sign In for Pricing

View Details

VR-RCCEC-AG-10 10 Tests

Rotavirus+Cryptosporidia+Coronavirus+E. Coli Antigen Combo Rapid Test device (Feces)

Sign In for Pricing

View Details

A17856-50UG 50 µg

FOXP3 Antibody

Sign In for Pricing

View Details

orb1536231 50 μL

GPX4/MCSP Antibody

Sign In for Pricing

View Details

MBS1605258-01 48 Well

Mouse Low density lipoprotein receptor-related protein 4, LRP4 ELISA Kit

Sign In for Pricing

View Details