What is the catalog number for CXCR2 Peptide - C-terminal region?

The catalog number for CXCR2 Peptide - C-terminal region is orb1997810.

What sizes are available for CXCR2 Peptide - C-terminal region?

CXCR2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is CXCR2 Peptide - C-terminal region in stock?

CXCR2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

CXCR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Il8rb, Cmkar2

UniProt

P35407

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-08884C 100 µL

Mouse Monoclonal eIF4E Antibody (PCRP-EIF4E-1D3) [DyLight 650]

Sign In for Pricing

View Details

E917433 100 µL

PIK3R2 Polyclonal Antibody

Sign In for Pricing

View Details

NBP2-99160MFV500 0.1 mL

Rabbit Polyclonal MANBA Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

OKDD00737 96 Well

LSR ELISA Kit (Mouse) (OKDD00737)

Sign In for Pricing

View Details

TL507757V 500 µL Each

Olfr1368 Mouse shRNA Lentiviral Particle (Locus ID 258527)

Sign In for Pricing

View Details

E38PA6490 100 µL

PTEN (Acetyl-K402) Antibody

Sign In for Pricing

View Details