CXCR2 Peptide - C-terminal region
CXCR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Il8rb, Cmkar2
UniProt
P35407
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_058879
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15150960 1 Vial
Lentiviral mouse Vmn1r41 shRNA (UAS) - Lentiviral mouse Vmn1r41 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
55303151 3x 1.0 µg DNA
CECR4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details 